PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG516900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 270aa    MW: 29823.9 Da    PI: 4.5903
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG516900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS193.11.8e-591266123373
                 GRAS 123 lQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvl.......vakrledleleeLrvkpgEa 201
                          +Q p+L++ LasR+egpp lR+T+ + + s        ++ e+g +L +fA++ +++++f+v+        ++ +++l++++L ++  Ea
  Pavir.2KG516900.1.p   1 MQIPTLIDMLASRSEGPPILRLTVADVAPSApppaLDMSYDELGAKLINFARSRNMSMDFRVVttspadaFTSLVDQLRVQQLVLDGTEA 90 
                          7***********************98866667877778899**********************666655445556677888888888*** PP

                 GRAS 202 laVnlvlqlhrlldesvsles......erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                          l+Vn+++ lh+++de++ + s       r+ +Lk +++l P++vvvve++ad ++++ + r+  a+++ +  +d++++ lp+ se+r+++
  Pavir.2KG516900.1.p  91 LVVNCHMLLHTVPDETAGSVSlaqpvsLRTMLLKSLRTLDPNLVVVVEEDADFTAGDVVGRLRAAFNFLWIPYDAVDTFLPKGSEQRRWY 180
                          *************998777666657767999*********************************************************** PP

                 GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          E+e +g++++nv+a+eg +r+er+e  ++W +r+++aGF++v+++e+aa ++k++l++++  g+ ++ e++ lvl+Wk++++v++SaW
  Pavir.2KG516900.1.p 181 EAE-IGWKVENVLAQEGVDRVERQEDRARWDQRMRSAGFRAVAFGEEAAGEVKAMLNEHA-AGWGMKREDDDLVLTWKGHNVVFASAW 266
                          ***.********************************************************.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035146.1E-571266IPR005202Transcription factor GRAS
PROSITE profilePS5098530.6891248IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MQIPTLIDML ASRSEGPPIL RLTVADVAPS APPPALDMSY DELGAKLINF ARSRNMSMDF  60
RVVTTSPADA FTSLVDQLRV QQLVLDGTEA LVVNCHMLLH TVPDETAGSV SLAQPVSLRT  120
MLLKSLRTLD PNLVVVVEED ADFTAGDVVG RLRAAFNFLW IPYDAVDTFL PKGSEQRRWY  180
EAEIGWKVEN VLAQEGVDRV ERQEDRARWD QRMRSAGFRA VAFGEEAAGE VKAMLNEHAA  240
GWGMKREDDD LVLTWKGHNV VFASAWAPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432380.0AC243238.1 Panicum virgatum clone PV_ABa020-K10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460950.10.0hypothetical protein SORBIDRAFT_02g038040
SwissprotQ9SN221e-101SCL32_ARATH; Scarecrow-like protein 32
TrEMBLC5XD470.0C5XD47_SORBI; Putative uncharacterized protein Sb02g038040
STRINGSb02g038040.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.14e-86GRAS family protein